DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl4

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:297 Identity:124/297 - (41%)
Similarity:181/297 - (60%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVNATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERT 66
            |.|.| |:::.:.:: :||.|..||.|::||.|.|.|...||.||  | |||:||||:||::...
  Rat    18 AFNDT-VEFYRWTWS-IADKRVEDWPLMQSPWPTLSISTLYLLFV--WLGPKWMKDREPFQMRLV 78

  Fly    67 LLVYNFFQVALSVWMVYEGVVIWQY---YSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDT 128
            |::|||..|.|::: ::..:.:..|   ||:.||.||:|......|.|..::.|:::|..|.|||
  Rat    79 LIIYNFGMVLLNLF-IFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDT 142

  Fly   129 IFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQ 193
            :||:|||.:.||:|||||||..|..:.|...|:..||...|...:|||:|:||||||.|:||||.
  Rat   143 VFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPW 207

  Fly   194 MQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKK 258
            :|||||||:|:|.||::||.....|....|||||.:|:|.....:..|:.|.|||.:||.::|.:
  Rat   208 IQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNE 272

  Fly   259 KQAAAKEKALSADNNNDGCAKDLNKAIQLQQEKQKAL 295
            .:.:...|..:    |...|..:||:     |||..|
  Rat   273 PKKSKTGKTAT----NGISANGVNKS-----EKQLVL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 103/227 (45%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 106/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41488
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.