DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl3

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:287 Identity:79/287 - (27%)
Similarity:135/287 - (47%) Gaps:45/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TQVDYWNFLFTDLADPRTNDWFLIKSPLPLLG--------ILAFYLFFVLSWGPKFMKDRKPFKL 63
            |.:::...|.|:|..|  .|:.:.:...|.|.        |:..||..:: :|..:||.||.|.|
  Rat     3 TSMNFSRGLKTELIQP--YDFEMSQDLRPFLEEYWVSSFFIVLVYLLLII-FGQNYMKTRKGFSL 64

  Fly    64 ERTLLVYNFFQVALSVWMVYEGVVIWQYYSWRCQPVDWSRTP--KAYREARVV----YVYYLAKI 122
            :|.|::::|   .|:::.:...:.:|::.......:...:|.  ..|....:|    :|:.|:|:
  Rat    65 QRPLILWSF---CLAIFSILGTLRMWKFMGTVLFTMGLKQTVCFTDYTNDAIVKFWSWVFLLSKV 126

  Fly   123 TELLDTIFFVLRKNDRQVTFLHVYHH-TVMPMISWGTSKYYPGGHGTFIGW---INSFVHIIMYS 183
            .||.||.|.:|||  |.:.|:|.||| ||:...|:|.....|.|     ||   :|..||.:||:
  Rat   127 VELGDTAFIILRK--RPLIFVHWYHHSTVLLFTSFGYKNKVPSG-----GWFMTMNLGVHSVMYT 184

  Fly   184 YYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFI--------HQTQLLYTDCGYPRWSVCFTLPN 240
            ||.:.|...:....|  ...||:||::|.....|        .|.:..||...:..||  |.|..
  Rat   185 YYTMKAAKVKHPNIL--PMVITSLQILQMVLGTIFGILNYIWRQERGCYTTSEHFFWS--FVLYG 245

  Fly   241 AVFFYFLFNDFYQKSYKKKQAAAKEKA 267
            .  ::.||..|:.::|.:.:..|:.|:
  Rat   246 T--YFILFAQFFHRAYLRPKRKAESKS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 69/249 (28%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.