DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elo-8

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:292 Identity:72/292 - (24%)
Similarity:117/292 - (40%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYN-FFQVALSVWMVYEGVV 87
            |.:|.|:  |:.||||  ||:|...::.|..:.||...|   ....|| .||:.|.:.|:.| ::
 Worm    10 TINWSLL--PIHLLGI--FYVFVAFNFRPSHISDRSYLK---EWYYYNCVFQLGLGILMIPE-IL 66

  Fly    88 IWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMP 152
            ......|.............:....||.::...|:.:||:|:  :|..:.|:...:|:.||.:  
 Worm    67 TSSLSGWHYSVCHSGTLYTGFFSGSVVAIWTFTKVVDLLETM--LLLYDARRPLTIHIIHHFL-- 127

  Fly   153 MISWGTSKYYPGGHGTFIGWI---NSFVHIIMYSYYFLSAFGPQMQKYL--W---WKKYITNLQM 209
            .:|:..:.|  ..:.....||   |...|:.:|:|  ||.|     |.|  |   |.. :.:.||
 Worm   128 SLSFAFTFY--SQNFALHRWIVFFNLTAHVFLYAY--LSGF-----KILNRWTPCWVA-VCSSQM 182

  Fly   210 IQFCCAFIHQTQLLYTDCGYPRWSVC-------FTLPNAV-FFYFLFNDFYQKSYKKKQAAAKEK 266
            :|....||   ..........|.:.|       .||...: ....||.:||   :.:.||..|:.
 Worm   183 LQLILPFI---ATFSAAAKLARGTRCDANALGLLTLQIGLGVLIILFAEFY---WSRVQAFRKKN 241

  Fly   267 ALS---ADNNNDGCAKDLNKAIQLQQEKQKAL 295
            ..|   ..:|:|..          :||.:|.|
 Worm   242 MKSGGGGTSNSDSS----------EQESEKVL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 58/240 (24%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 63/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.