DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elo-7

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:236 Identity:71/236 - (30%)
Similarity:115/236 - (48%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YLFFVLSWGPKFMKDRKPFKLERTLLVYNFFQVALSVWMVY----------EGVVIWQYYSWRCQ 97
            |:..|.|. .:||:||:||:|...|.::|||   |||:.:|          :.:.::..|...|:
 Worm    76 YVILVFSI-KRFMRDREPFQLTTALRLWNFF---LSVFSIYGSWTMFPFMVQQIRLYGLYGCGCE 136

  Fly    98 PVDWSRTPKAYREARV-VYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKY 161
            .:  |..|.   :|.. :::..|:|..|.:||.|.||||  :.:.|||.|||  |....:..|.|
 Worm   137 AL--SNLPS---QAEYWLFLTILSKAVEFVDTFFLVLRK--KPLIFLHWYHH--MATFVFFCSNY 192

  Fly   162 YPGGHGTFIGWI-NSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLLYT 225
            ......:.:|.| |.|||..||.|||..:...::...:  ...:|.||:.||.| ||:...|:|.
 Worm   193 PTPSSQSRVGVIVNLFVHAFMYPYYFTRSMNIKVPAKI--SMAVTVLQLTQFMC-FIYGCTLMYY 254

  Fly   226 D-------CGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKK 259
            .       |..|.:.:..|...:..::.||.:|:.|:|.::
 Worm   255 SLATNQYTCDTPMFVLHSTFALSSSYFVLFANFFHKAYLQR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 68/227 (30%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.