DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and elo-1

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:261 Identity:85/261 - (32%)
Similarity:136/261 - (52%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILAFYLFFVLSWGPK-FMKDRKPFKLERTLLVYNF----FQVALSVWMVYE--------GVVIWQ 90
            |.|..|:.|:.:|.| ||::|:||:|...|.::||    |.:|.:|.|..|        |:|. .
 Worm    48 IQASILYMVVVFGTKWFMRNRQPFQLTIPLNIWNFILAAFSIAGAVKMTPEFFGTIANKGIVA-S 111

  Fly    91 YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMIS 155
            |    |:..|:::....|    .|:::..:|:.||:||||.||||  |.:.|||.|||.:..:.:
 Worm   112 Y----CKVFDFTKGENGY----WVWLFMASKLFELVDTIFLVLRK--RPLMFLHWYHHILTMIYA 166

  Fly   156 WGTSKYYPG--GHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF---CCA 215
            |.:....||  .:|.::.::   ||..|||||||.:...::..::  .:.||:||::||   |..
 Worm   167 WYSHPLTPGFNRYGIYLNFV---VHAFMYSYYFLRSMKIRVPGFI--AQAITSLQIVQFIISCAV 226

  Fly   216 FIHQTQLLY---TDCGYPRWSVCFTLPNAVF----FYFLFNDFYQKSYKKKQAAAKEKALSADNN 273
            ..|...|::   .:|.:.. || |.|  |||    :..||.:|:.:||..:....|.||:....|
 Worm   227 LAHLGYLMHFTNANCDFEP-SV-FKL--AVFMDTTYLALFVNFFLQSYVLRGGKDKYKAVPKKKN 287

  Fly   274 N 274
            |
 Worm   288 N 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 77/237 (32%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.