DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and Elovl5

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:256 Identity:102/256 - (39%)
Similarity:146/256 - (57%) Gaps:7/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERTLLVYNFFQVALSVWMVYE 84
            |.|...|||:.:.:|.....|.||..|  | |||:||:|:||.....|:|||.....||::|.||
  Rat    20 DTRVKGWFLLDNYIPTFVCSAIYLLIV--WLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYE 82

  Fly    85 GVV-IWQ-YYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLRKNDRQVTFLHVYH 147
            .|. :|: .|::.||... |......:..||::.||.:|:.|.:||.||:||||:.|:|.|||||
  Rat    83 LVTGVWEGKYNFFCQGTR-SAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYH 146

  Fly   148 HTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYLWWKKYITNLQMIQF 212
            |..|..|.|....:.|.||..|...:|||:|::|||||.||:. |.|:.|||||||||..|::||
  Rat   147 HATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQF 210

  Fly   213 CCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQAAAKEKALSADNN 273
            ....|..:..:...|.:|...:.|.:...:....||.:||.::|.||.|:.:::.|....|
  Rat   211 VLTIIQTSCGVIWPCSFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKEHLKGHQN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 91/226 (40%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 97/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.