DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sit and MGC115163

DIOPT Version :9

Sequence 1:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_017953097.1 Gene:MGC115163 / 101732387 XenbaseID:XB-GENE-5892987 Length:277 Species:Xenopus tropicalis


Alignment Length:275 Identity:116/275 - (42%)
Similarity:163/275 - (59%) Gaps:17/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAVNATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLER 65
            |.::.....|::::...: .||||:.|.|:.||:|::.|.|.||..| :.||:.|..|:.|.|..
 Frog    13 MGSMWEAATDFYSWALHN-GDPRTDPWLLVYSPVPVILIFAVYLVLV-ALGPRLMDKREAFTLRS 75

  Fly    66 TLLVYNFFQVALSVWMVYEGVV--IWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDT 128
            .||:||...|.||.:|.||.:|  :...||:.|||||::.:....|.|||.:.::.:|:.|||||
 Frog    76 VLLIYNLALVGLSAYMFYEFLVTSVLAGYSYLCQPVDYTDSQLGLRMARVCWWFFFSKVIELLDT 140

  Fly   129 IFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQ 193
            |||::||...|::|||||||..|....|...||..||...|||.:||||||.||.||.|:..||:
 Frog   141 IFFIMRKKFNQISFLHVYHHATMIFNWWAGVKYVAGGQAFFIGMLNSFVHIFMYLYYGLAVLGPK 205

  Fly   194 MQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFY-----FLFNDFYQ 253
            :|||||||:|:|.||:.||....:|....|.|||.:|.     ....|||.|     .||.:||.
 Frog   206 VQKYLWWKRYLTLLQLTQFGAIALHSGYNLVTDCPFPD-----GFNAAVFAYIVSLIILFLNFYY 265

  Fly   254 KSYKKKQAAAKEKAL 268
            ::|.::   .:||.|
 Frog   266 QTYLRR---PREKKL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sitNP_651063.1 ELO 28..252 CDD:279492 103/230 (45%)
MGC115163XP_017953097.1 ELO 40..276 CDD:366492 107/244 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.