DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and ELO1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_012339.1 Gene:ELO1 / 853243 SGDID:S000003732 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:69/259 - (26%)
Similarity:125/259 - (48%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYS-IWMCRTSIQESNVM- 91
            :|.|.||:..:.:|...:.. |...:|:.||:.|:.|...:|......| :|:.....|...:: 
Yeast    59 LSEPRPVLLFIAMYYVVIFG-GRSLVKSCKPLKLRFISQVHNLMLTSVSFLWLILMVEQMLPIVY 122

  Fly    92 -ASIFSKKCEINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLF 155
             ..::...|.:....:...|||   :..:.:|.::..||...||  |..:::|||.|||..|.|.
Yeast   123 RHGLYFAVCNVESWTQPMETLY---YLNYMTKFVEFADTVLMVL--KHRKLTFLHTYHHGATALL 182

  Fly   156 SW----GY--LKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFV 214
            .:    ||  :.:.|       ..||..||::||:||.::|.|.:    :|||.::|.:|::||:
Yeast   183 CYNQLVGYTAVTWVP-------VTLNLAVHVLMYWYYFLSASGIR----VWWKAWVTRLQIVQFM 236

  Fly   215 L---ILGYML---TVGA--KGCNMPK------TLTFFFVGNTVI--FLYLFGNFYRKTYKKAKS 262
            |   ::.|:|   .|.|  |....|:      ::|....|..::  :|:||.:||.:.||:..:
Yeast   237 LDLIVVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFYIEVYKRGSA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 69/257 (27%)
ELO1NP_012339.1 ELO 58..303 CDD:395916 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.