DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and HOS3-1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:180 Identity:42/180 - (23%)
Similarity:74/180 - (41%) Gaps:47/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LYSIWMCRTSIQESNVMASI-FSKKCEINRTR-----------EQNLTLY------SGA---WFY 118
            ::|:.|   ||..:.:.|.| .|...||..||           .|.|..:      ||.   |.|
plant    73 IHSLLM---SILSATIFAGILLSAAAEIRDTRWLWRRSKTATPLQWLLCFPLGTRPSGRVFFWSY 134

  Fly   119 FF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSG-VHI 180
            .|  ::.:.:..|.|.|||.:...||  .::.:::....|:.:|:::...|  |:.||::. |:.
plant   135 VFYLTRFLHMFRTIFAVLRSRRLAVS--QLFCNSVMAFTSFLWLEFSQSYQ--ILAILSTTLVYS 195

  Fly   181 IMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVLILGYMLTVGAKGCNM 230
            ::|.|......|      |....:.:.:...|.||:          |||:
plant   196 VVYGYRFWTGFG------LPGSAFPSFVVNCQLVLV----------GCNL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 42/180 (23%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.