DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and AT3G06460

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:253 Identity:81/253 - (32%)
Similarity:124/253 - (49%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVAVVLVYLA--FVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWM---CRTS-IQESNVMAS 93
            |..||.:||:  |:|:...:.:....|..||.|...::....|.|:.|   |..| |..|:..|.
plant    36 VFVVVSLYLSATFLLRYTVDSLPTLGPRILKPITAVHSLILFLLSLTMAVGCTLSLISSSDPKAR 100

  Fly    94 IFSKKCEINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWG 158
            :|...|.....:.:. .|:..|..::.|||::.:||...:|.|...::||||||||...|:..:.
plant   101 LFDAVCFPLDVKPKG-PLFFWAQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYHHATVVILCYL 164

  Fly   159 YLKYAPGEQGVI-IG-ILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVLILG--- 218
            :|:   ..|.:. :| :|||.||:|||.||.:.|:|.:.:    |||.:|:.|::||...:|   
plant   165 WLR---TRQSMFPVGLVLNSTVHVIMYGYYFLCAIGSRPK----WKKLVTNFQMVQFAFGMGLGA 222

  Fly   219 -YMLTVGAKGCNMPKTLTFFFVG-NTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSL 274
             :||.....|.......|.:|.| .|...|.||.||:.|.|:|         ||.|.|
plant   223 AWMLPEHYFGSGCAGIWTVYFNGVFTASLLALFYNFHSKNYEK---------TTTSPL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 77/239 (32%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.