DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and ELOVL6

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:262 Identity:68/262 - (25%)
Similarity:114/262 - (43%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSW---FLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTSI 85
            ::|   ||.|:         :|.||:.. |...|..|...:|::.:|.::....::||:   .::
Human    28 ENWKKSFLFSA---------LYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIF---GAL 79

  Fly    86 QESNVMASIFSKKCEINRTREQNLTLYSGA----WFYFF--SKIIDLLDTTFFVLRKKDNQVSFL 144
            :....|..|...|.......:|.  .|:|.    |.|.|  ||..:|.||.|.:|||:  ::.||
Human    80 RTGAYMVYILMTKGLKQSVCDQG--FYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQ--KLIFL 140

  Fly   145 HVYHHTITVLFSW-GYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSI 208
            |.|||...:|:|| .|.....|  |.....:|.|||.:||.||.:.|.|.:..:.  :..::|..
Human   141 HWYHHITVLLYSWYSYKDMVAG--GGWFMTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLS 201

  Fly   209 QLIQFVL--ILGYMLTVGAKGCNMPKT-----------LTFFFVGNTVIFLYLFGNFY----RKT 256
            |:.|.::  ::.|::.     |.|...           .:..::...|:|.:.|...|    |||
Human   202 QITQMLMGCVVNYLVF-----CWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKT 261

  Fly   257 YK 258
            .|
Human   262 TK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 67/256 (26%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.