DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:288 Identity:101/288 - (35%)
Similarity:158/288 - (54%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNYIKIVEERISGLSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRI 65
            |...:.:.:|    |.|..|..:.::.||.||:.:.:::|.|:.|||.:||..|.||||..|:..
  Rat     1 MEAVVNLYQE----LMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGF 61

  Fly    66 MVFYN----------AFQVLYSIWMCRTSIQESNVMASIFSKKCE-IN-RTREQNLTLYSGAWFY 118
            |:.||          .::.|.|.|:            |.::.:|: :: ....:.|.:...||.:
  Rat    62 MIVYNFSLVTLSLYIVYEFLMSGWL------------STYTWRCDPVDFSNNPEALRMVRVAWLF 114

  Fly   119 FFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMY 183
            ..||:|:|:||..|:|||||.||:||||:||::.....|..:|.|||..|....::||.||::||
  Rat   115 MLSKVIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMY 179

  Fly   184 FYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVLI-LGYMLTVGAKGCN--MPKTLTFFFVGNTVIF 245
            .||.::|:||..|.||||||:||:||||||||: |..........||  .|..:...::..|:.|
  Rat   180 LYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFF 244

  Fly   246 LYLFGNFYRKTYKKAKSVDGGSRTTGSS 273
            : ||.||:..:|.|.|.:....:..|::
  Rat   245 I-LFSNFWYHSYTKGKRLPRAVQQNGAA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 94/249 (38%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 94/249 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.