DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and ELOVL5

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:336 Identity:101/336 - (30%)
Similarity:160/336 - (47%) Gaps:66/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWM-CRT 83
            |..|..|||:.:.:|.....::|| .::.:||:||:|::|...:.|:|.||....|.|::| |.:
Human    20 DTRVKGWFLLDNYIPTFICSVIYL-LIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83

  Fly    84 --------------------SIQESNVMASIFSKK----CEINRTR-EQNLTLYSGAWFYFFSKI 123
                                .:.|:.::..::..|    |:..||. |.::.:....|:|:|||:
Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKL 148

  Fly   124 IDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMV 188
            |:.:||.||:|||.::|::.||||||...:...|..:.:.|.........|||.:|::||.||.:
Human   149 IEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGL 213

  Fly   189 AAMGPQYQKYLWWKKYMTSIQLIQFVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFY 253
            ::: |..:.|||||||:|..||:||||.:..........|..|....:|.:|..:..:.||.|||
Human   214 SSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFY 277

  Fly   254 RKTYKKAKSVDGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLL--QNGQVG------KAYID 310
            .:||.|    .|.||..                         .||.  |||.:.      .::..
Human   278 IQTYNK----KGASRRK-------------------------DHLKDHQNGSMAAVNGHTNSFSP 313

  Fly   311 LNNNSVKPMKL 321
            |.|| |||.||
Human   314 LENN-VKPRKL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 82/260 (32%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.