DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:291 Identity:107/291 - (36%)
Similarity:164/291 - (56%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERISGLSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYN---- 70
            ::.....||.|..:..:.||.||....|::|.|:.|||.:||..|.||||.|||.:||.||    
 Frog    10 QKYHNFMKGADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNFSLV 74

  Fly    71 ------AFQVLYSIWMCRTSIQESNVMASIFSKKC---EINRTREQNLTLYSGAWFYFFSKIIDL 126
                  .::.|.|.|:            :.::.:|   :::.| ...|.:...||.:.|||.|:|
 Frog    75 ALSAYIVYEFLMSGWL------------TGYTWRCDPVDVSDT-PMALRMVRVAWLFLFSKFIEL 126

  Fly   127 LDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAM 191
            |||.|||:|||::|::|||::||::.....|..:|:.||..|....::||.||:||||||.::|.
 Frog   127 LDTVFFVVRKKNSQITFLHIFHHSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAA 191

  Fly   192 GPQYQKYLWWKKYMTSIQLIQFVLI---LGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFY 253
            ||::||||||||:||:||||||||:   :.....:.:.....|..:...::..||.|: ||.||:
 Frog   192 GPRFQKYLWWKKHMTAIQLIQFVLVSIHISQYYFMSSCDYQYPIFIHLIWIYGTVFFI-LFSNFW 255

  Fly   254 RKTYKKAKSVDGGSRTTGSSLAQSALRAAGG 284
            .:.|.|.:.:..||.....:|.|:. :|..|
 Frog   256 YQAYTKGRRLPKGSTVANGALHQNG-KAKNG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 98/250 (39%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 98/253 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.