DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001034265.1 Gene:Elovl1 / 54325 MGIID:1858959 Length:279 Species:Mus musculus


Alignment Length:267 Identity:101/267 - (37%)
Similarity:155/267 - (58%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIW 79
            |.|..|..:.|:.||.||:.:.:::|.|:.|:|.:||..|.||||..|:..|:.||...|:.|::
Mouse    11 LMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRGFMIVYNFSLVILSLY 75

  Fly    80 MCRTSIQESNVMASIFSKKCE-INRTRE-QNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVS 142
            :....:...  ..|.::.:|: |:.:.. :.|.:...||.:..||:|:|:||..|:|||||.||:
Mouse    76 IVYEFLMSG--WLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVT 138

  Fly   143 FLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTS 207
            ||||:||::.....|..:|.|||..|....::||.||::||.||.::|:||..|.||||||:||:
Mouse   139 FLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTA 203

  Fly   208 IQLIQFVLI-LGYMLTVGAKGCN--MPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSV------ 263
            ||||||||: |..........||  .|..:...::..|:.|: ||.||:..:|.|.|.:      
Mouse   204 IQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFI-LFSNFWYHSYTKGKRLPRAVQQ 267

  Fly   264 DGGSRTT 270
            :|...||
Mouse   268 NGAPATT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 93/239 (39%)
Elovl1NP_001034265.1 ELO 23..260 CDD:366492 93/239 (39%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279 101/267 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.