DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl5

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:276 Identity:90/276 - (32%)
Similarity:146/276 - (52%) Gaps:9/276 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKIVEERISG----LSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRI 65
            ::::::.::|    |....|..|..|.|:.:.:|.:....:|| |::..||:||:||.|:..:.|
 Frog     1 MEVLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYL-FIVWRGPKYMQNRPPVSCRGI 64

  Fly    66 MVFYNAFQVLYSIWMCRTSIQESNVMASIFSKKC-EINRTREQNLTLYSGAWFYFFSKIIDLLDT 129
            :|.||....|.|::|....:  :.|....::..| :.|...:.:..:....|:|:|||:|:.:||
 Frog    65 LVVYNLGLTLLSLYMFYELV--TGVWEGGYNFFCQDTNSGGDADTKIVRVLWWYYFSKLIEFMDT 127

  Fly   130 TFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQ 194
            .||:|||.::|::.||||||...:...|..:.:.|.........|||.:|::||.||.::|: |.
 Frog   128 FFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI-PA 191

  Fly   195 YQKYLWWKKYMTSIQLIQFVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKK 259
            .:.|||||||:|..||.||||.:..........|..|....:|.....:..:.||||||.|||.|
 Frog   192 MRPYLWWKKYITQCQLTQFVLTMTQTTCAMIWPCKFPMGWLYFQNCYMISLIILFGNFYIKTYNK 256

  Fly   260 AKSVDGGSRTTGSSLA 275
            ..|........||:.|
 Frog   257 KTSSRRKEYQNGSASA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 81/235 (34%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 82/236 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.