DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Baldspot

DIOPT Version :10

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_001237830.3 Gene:Baldspot / 4576681 VectorBaseID:AGAMI1_012789 Length:315 Species:Anopheles gambiae


Alignment Length:110 Identity:25/110 - (22%)
Similarity:43/110 - (39%) Gaps:30/110 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 ISKDNMLLISEDVIEVGRNSSKSQVDFHVGKNSFISRKHFIIQHDMND--EFTLFCLSKNGVFID 241
            :|:|   :.::|.|::.:||.   :.|         :||   :.|..|  :|....:|...|.::
Mosquito   116 LSED---MYAQDSIDLLQNSG---IQF---------KKH---EEDGIDPIDFAELLMSSGIVLVE 162

  Fly   242 NV----FHRKSGEPYKLPKLCSIRFPSTN------IKIQFENLID 276
            |:    ||......|.|..|.....|...      :.|.|.|:.|
Mosquito   163 NIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPNIFD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 45..263 CDD:460083 20/89 (22%)
BaldspotXP_001237830.3 None

Return to query results.
Submit another query.