DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl1a

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001005989.1 Gene:elovl1a / 449816 ZFINID:ZDB-GENE-041010-66 Length:315 Species:Danio rerio


Alignment Length:325 Identity:114/325 - (35%)
Similarity:168/325 - (51%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIW 79
            |.|..|..|..:.||.||:.:..::|.|:..||.:||.||.:|||..|...|:.||.|.|.::.:
Zfish    16 LLKRTDARVRDYPLMQSPILMTFILLGYVFSVLYVGPRYMASRKPFRLNTAMIAYNFFMVAFNAY 80

  Fly    80 MCRTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVS 142
            .....:...  .|:.::.:|::  ..:..|.|.:...||.::|||.|:||||.|||||||.:||:
Zfish    81 TVYEFLMSG--WATTYTWRCDLCDPSSSPQALRMVRAAWLFYFSKYIELLDTVFFVLRKKHSQVT 143

  Fly   143 FLHVYHHTITV-LFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMT 206
            |||::||::.. .:.||......|..|....::|:.||:|||.||.:||.||::|||||||||||
Zfish   144 FLHIFHHSVLPWTWWWGITLTPAGGMGSFHALVNACVHVIMYTYYGLAAAGPRFQKYLWWKKYMT 208

  Fly   207 SIQLIQFVLILG-----YMLTVGAKGCNMPKTL---------TFFFVGNTVIFLYLFGNFYRKTY 257
            :||||||||:.|     |.:    :.|:....:         ||||:        ||.||:.:.|
Zfish   209 AIQLIQFVLVTGHISQYYFM----EKCDYQVPIFIHLILIYGTFFFI--------LFSNFWIQAY 261

  Fly   258 KKAKSV-----DGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLLQNGQVGKAYIDLNNNSVK 317
            .|.|.:     |...|....::..            |..:..||| |:||....:....:|..||
Zfish   262 IKGKRLPVSNEDKPKRNGVITVID------------PVVVANGKH-LENGNAHYSNGFAHNGKVK 313

  Fly   318  317
            Zfish   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 97/251 (39%)
elovl1aNP_001005989.1 ELO 28..266 CDD:279492 97/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.