DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and zgc:92749

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001002570.1 Gene:zgc:92749 / 436843 ZFINID:ZDB-GENE-040718-309 Length:266 Species:Danio rerio


Alignment Length:261 Identity:74/261 - (28%)
Similarity:118/261 - (45%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SW---FLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI-WMCRTSI 85
            :|   |::|.    ...||::|      |..:||:|:.:||:..:|.::....::|| ...||..
Zfish    26 NWGYSFVLSG----TYAVLIFL------GHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGW 80

  Fly    86 QESNVMASIFSKKCEINRTREQNLTLYSGA----WFYFF--SKIIDLLDTTFFVLRKKDNQVSFL 144
            ...||:.|      |..|....:...||..    |.:.|  ||..:|.||.|.||||:  ::.||
Zfish    81 YMFNVVCS------EGFRQSVCDTDFYSAPVSKFWAFAFAISKAPELGDTVFVVLRKQ--RLIFL 137

  Fly   145 HVYHHTITVLFSW-GYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSI 208
            |.|||...:|:|| .|..:..|  |.....:|..||..||.||...|.|.:..:.  :...:|.:
Zfish   138 HWYHHITVLLYSWFSYKDHVAG--GGWFMSMNFTVHAFMYSYYTAKAAGVRVPRA--FAMLITVL 198

  Fly   209 QLIQF---VLILGYMLT-VGAKGCNMPKTLTFFFVGNTVIFLY--LFGNFYRKTYKKAKSVDGGS 267
            |:.|.   :.:||.:.: ...:.|........|  |:.:.|.|  ||..|:.::|  .:..|||.
Zfish   199 QISQMAAGLTVLGLVYSWKHEQHCKSTDNNIIF--GSAMYFSYLPLFCAFFYQSY--IRRSDGGQ 259

  Fly   268 R 268
            :
Zfish   260 K 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 70/248 (28%)
zgc:92749NP_001002570.1 ELO 22..255 CDD:279492 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.