DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and CG6660

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651104.1 Gene:CG6660 / 42708 FlyBaseID:FBgn0039030 Length:272 Species:Drosophila melanogaster


Alignment Length:244 Identity:95/244 - (38%)
Similarity:141/244 - (57%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVL-----YSIWMCRTSIQESNVMASI 94
            |:|:|.:|:||||..||.:|.||.|.:|||:|..||..|||     :.|.:..|.:|..      
  Fly    33 VLAIVALYVAFVLHYGPRWMANRAPFELKRVMQVYNVVQVLANATIFVIGLSNTYLQPG------ 91

  Fly    95 FSKKCE----INRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLF 155
            :|..|:    .:|:.....|||: ::.|:..|.:|||||.|.|||||::||||||||||...|..
  Fly    92 YSWTCQPVDHTDRSPAMMKTLYA-SYAYYMLKYLDLLDTVFIVLRKKNSQVSFLHVYHHGGMVFG 155

  Fly   156 SWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQF-VLILGY 219
            ...::.:..|....::||:|..||.:||.||..|::| ..:..||||:.:|.:||:|| .|...:
  Fly   156 VSIFMTFLGGSHCSMLGIINLLVHTVMYAYYYAASLG-AVKNLLWWKQRITQLQLMQFGYLTFHF 219

  Fly   220 MLTVGAKGCNMPKTLTFF-FVGNTVIFLY-LFGNFYRKTY--KKAKSVD 264
            :|.:....|..|..:.|. |:.|  ||:: :|.:||.|||  |:.||.:
  Fly   220 LLVIVRNPCQFPVFIAFIGFIQN--IFMFSMFFDFYCKTYIRKQRKSAE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 93/240 (39%)
CG6660NP_651104.1 ELO 25..265 CDD:279492 94/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449564
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.