DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl4a

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:267 Identity:97/267 - (36%)
Similarity:159/267 - (59%) Gaps:6/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84
            |:.|:.|.||.||:|.:|:...||.| |.:||:||:.|:|..|::.::.||...|:.:.::.:..
Zfish    23 DKRVEKWPLMDSPLPTLAISSSYLLF-LWLGPKYMQGREPFQLRKTLIIYNFSMVILNFFIFKEL 86

  Fly    85 IQESNVMASIFSKKCE-INRTREQN-LTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVY 147
            ...:.  |:.:|..|: ::.:.:.| :.:.:..|:||.||.::.|||.||:||||.||:||||||
Zfish    87 FLAAR--AANYSYICQPVDYSDDPNEVRVAAALWWYFISKGVEYLDTVFFILRKKFNQISFLHVY 149

  Fly   148 HHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQ 212
            ||.......|..:|:..|.|......:|:.:|::||.||.:||.||:.||:||||||:|.||::|
Zfish   150 HHCTMFTLWWIGIKWVAGGQSFFGAHMNAAIHVLMYLYYGLAAFGPKIQKFLWWKKYLTIIQMVQ 214

  Fly   213 FVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQS 277
            |.:.:|:........|..||.:.:..:|..:.|:.||||||.:||::....| ..|...:..:..
Zfish   215 FHVTIGHTALSLYSDCPFPKWMHWCLIGYALTFIILFGNFYYQTYRRQPRRD-KPRALHNGASNG 278

  Fly   278 ALRAAGG 284
            ||.::.|
Zfish   279 ALTSSNG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 89/236 (38%)
elovl4aNP_957090.1 ELO 30..267 CDD:279492 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.