DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl7

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:291 Identity:114/291 - (39%)
Similarity:167/291 - (57%) Gaps:39/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMC 81
            |..|..|::|.|||||:|...::.:|:.||..:||:.|:||||.:||:.|:.||.|.||:|::||
  Rat    19 KDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMC 83

  Fly    82 RTSIQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFL 144
            ...:...  ..:.:|.:|:|  .....:.:.:....|.|:|||.|:|.||.|||||||::||:||
  Rat    84 YEFVMSG--WGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFL 146

  Fly   145 HVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQ 209
            ||:||||.....|..:|:|.|..|....:||:.||::|||||.:.||||.|||||||||::||:|
  Rat   147 HVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQ 211

  Fly   210 LIQFVLI---LGYMLTVGAKGCNMP-KTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTT 270
            |:||||:   :|.:..:  :.||.. ....:..:....|||.||.:|:.:.|.|      |.|  
  Rat   212 LVQFVLVTVHIGQIFFM--EDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTK------GQR-- 266

  Fly   271 GSSLAQSALRAAGGMGCMPQTMNAG----KH 297
                             :|:||..|    ||
  Rat   267 -----------------LPKTMENGNCKSKH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 102/240 (43%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 104/267 (39%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.