DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl7a

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_956169.1 Gene:elovl7a / 334217 ZFINID:ZDB-GENE-030131-6149 Length:288 Species:Danio rerio


Alignment Length:251 Identity:101/251 - (40%)
Similarity:153/251 - (60%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84
            |.....|.|||:|:|.:.:::.|:.||:.:||:.|:||||.||||:::.||.|.|..|::||...
Zfish    22 DPRTKGWLLMSNPIPQMLIIVFYIYFVISLGPKIMENRKPFDLKRVLIVYNIFVVSLSVYMCYEF 86

  Fly    85 IQESNVMASIFSKKCEI--NRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVY 147
            :...  ..:.::..|::  .....:.:.:.|..|.|:|||.|.:|||.|||||||..|::||||:
Zfish    87 LMAG--WGTGYTFGCDLVDYSQSPKAMRMASVCWLYYFSKFIVMLDTVFFVLRKKPKQITFLHVF 149

  Fly   148 HHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQ 212
            ||:|.....|..::::||..|....:||..||:|||.||:::|:||.:|::|||||::||:||||
Zfish   150 HHSIMPFTWWFGVRFSPGGLGTFHALLNCIVHVIMYTYYLLSALGPSFQRFLWWKKHLTSLQLIQ 214

  Fly   213 FVLILGYMLTVG------AKGCNMPKTLTFFFVG-NTVIFLYLFGNFYRKTYKKAK 261
            |||:     ||.      .|.|..|..|..:.:. ..:|||.||.||:...|.|.|
Zfish   215 FVLV-----TVHISQYFFMKDCPYPYPLFMYIIALYGIIFLLLFLNFWHHAYTKGK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 99/244 (41%)
elovl7aNP_956169.1 ELO 30..269 CDD:279492 99/243 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.