DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and CG31523

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:319 Identity:116/319 - (36%)
Similarity:170/319 - (53%) Gaps:28/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84
            |..|:.:||:|||:|.:.:.:.|..|...:||..|..||||:|:.::|.|||.|.::|.|:....
  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEY 85

  Fly    85 IQESNVMASIFSKKCE--INRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVY 147
            :...  ....:|.||:  ...|....:.:.:..|:|:.||..:..||.||:||||:..||.|||.
  Fly    86 LMSG--WWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVI 148

  Fly   148 HHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQ 212
            ||.......|..||:|||.......:|||.|||:||||||:|||||:||||:|||||:|:.|::|
  Fly   149 HHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQ 213

  Fly   213 FVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTY----------KKAKSVDGGS 267
            ||.|..:...:..:.|:.||....:...:.|:||:||.:||:..|          .||.....||
  Fly   214 FVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKANGYANGS 278

  Fly   268 RTTGSS--LAQSALRAAGGM---GCMPQTMNAGKHLLQNGQVGKAYID-------LNNN 314
            .:.|.|  |.:.....|.|.   .|||  :...:::...||...||.:       |:||
  Fly   279 ASNGHSKHLGEGDALIANGCNTGACMP--VMEDEYVKSKGQSNGAYKEGFFKEGVLSNN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 97/246 (39%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 95/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449621
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.