DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and CG31141

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:81/255 - (31%)
Similarity:134/255 - (52%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWM------------ 80
            |.:.|.|::.:::.||..|.|.|.::|::|:|.:|::::.:||.||:.|:|.|            
  Fly    17 LATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNIMMLLPGYYFMLVFQ 81

  Fly    81 -----CRTSIQESNVMASIFSKKCEINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQ 140
                 |.|.:|:.:.:.:  .::|.              ::.|:.:||:|||||.|.|||||.:|
  Fly    82 PYNFRCMTVLQQDHPLKN--WERCI--------------SYAYYINKIVDLLDTVFCVLRKKYSQ 130

  Fly   141 VSFLHVYHHTITVLFSWGYL---KYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWK 202
            ::||||:||.:  :.|.|||   .|..|.|...:...|..|||.||.||..|..|...:    ||
  Fly   131 ITFLHVFHHVL--MPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSAIKGNTVR----WK 189

  Fly   203 KYMTSIQLIQFVLILGY-MLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAK 261
            :|:|.:|::||:|:.|: .||...:.|...:...|....:..|...:|.|||.:.|.:.|
  Fly   190 RYLTLMQMLQFLLMFGHCALTAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYLRPK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 81/255 (32%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449566
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.850

Return to query results.
Submit another query.