DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:304 Identity:92/304 - (30%)
Similarity:135/304 - (44%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VDSWFL------------------------MSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLK 63
            ||.|.|                        ||....|:..:..|...:|. |...|.||||:..:
pombe    22 VDLWHLFEQLSIKTIGWNPSEFEYIPGKTPMSQWSSVIVSITAYYVIILS-GRAIMTNRKPLKQR 85

  Fly    64 RIMVFYNAFQVLYSIWMCRTSIQE--SNVMAS-IFSKKCEINRTREQNLTLYSGAWFYFFSKIID 125
            |:...:|....:.|..:....::|  .|.|.: :|...|:.....::.:|||   :..:.:|.::
pombe    86 RLFQLHNFILTIISGALLALLVEEVFRNYMRNGLFYCVCDSRHFTQRLVTLY---YLNYLTKYLE 147

  Fly   126 LLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAA 190
            |:||.|..|:||  .::|||.|||.||.|..:..|......|..:|| ||..||:|||.||.:||
pombe   148 LMDTVFLFLKKK--PLAFLHCYHHGITALLCFTQLLGRTSVQWGVIG-LNLYVHVIMYSYYFLAA 209

  Fly   191 MGPQYQKYLWWKKYMTSIQLIQFV--LILGYMLT--------------VGAKGCNMPKTLTFFFV 239
            .|    :.:|||:::|.:|:||||  |||.|..|              ||  .|:......||..
pombe   210 CG----RRVWWKQWVTRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVG--DCSGSLFAAFFGC 268

  Fly   240 GNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQSALRAAG 283
            |....:|:||..||..||.|..:.....:..|.:...|...|||
pombe   269 GVLSSYLFLFIGFYINTYIKRGAKKNQRKAAGKADNTSVAAAAG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 84/277 (30%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.