DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and CG30008

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:246 Identity:89/246 - (36%)
Similarity:134/246 - (54%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTSIQES 88
            |.|::       :.|:::||.||.|.||.:|:.|||.:|||:::.:|..||:..|:..:..:..:
  Fly    21 DPWYM-------ITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVVSCIYAIKEVLYIT 78

  Fly    89 NVMASIFSKKCEINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITV 153
            :....||.|..:|..:.|.....|:.|:|.|:.||.:|::|..||||||.||||.||::||..||
  Fly    79 DNTIYIFWKCRDIGSSPELVRRYYNLAYFLFWLKISELIETVIFVLRKKQNQVSKLHIFHHFSTV 143

  Fly   154 LFSWGYLKY-APGEQGVIIGILNSGVHIIMYFYYMVAAMGPQ--YQKYLWWKKYMTSIQLIQFVL 215
            ...:..:.: ..|........|||.||:|||.||.|||:..:  .|.....||.:|.||:.||||
  Fly   144 TLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKKCITVIQMTQFVL 208

  Fly   216 IL---GYMLTVGAKGCNMPKTLTFFFVGNTVI--FLYLFGNFYRKTYKKAK 261
            ||   .:.|.:    |.||..:..:|  .|||  ..|.|.:||...|:.::
  Fly   209 ILTQVAFQLVL----CGMPPLVLLYF--TTVILGMFYGFYDFYNSAYQASQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 87/243 (36%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 89/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449558
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.