DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elo-3

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001367447.1 Gene:elo-3 / 183948 WormBaseID:WBGene00001241 Length:320 Species:Caenorhabditis elegans


Alignment Length:250 Identity:64/250 - (25%)
Similarity:112/250 - (44%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI-------------WMCRTSIQE 87
            :...:||:| |:..|.:.|:..||..|...:..:|:|..::||             |....:..:
 Worm    42 ITASVVYVA-VIFTGKKIMEKYKPFQLDTPLFVWNSFLAIFSILGFLRMTPEFVWSWSAEGNSFK 105

  Fly    88 SNVMASIFSKKCEINRTREQNLTLYSGAWF--YFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHT 150
            .::..|.::          |.:|   |.|.  :..||:.:|:||.|.||||:  .:.|||.|||.
 Worm   106 YSICHSSYA----------QGVT---GFWTEQFAMSKLFELIDTIFIVLRKR--PLIFLHWYHHV 155

  Fly   151 ITVLFSW-GYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFV 214
            ..::::| .|..:....:..|  .:|.|||.:||.||.:.::..:..|.:  ...:|::||.|.|
 Worm   156 TVMIYTWHAYKDHTASGRWFI--WMNYGVHALMYSYYALRSLKFRLPKQM--AMVVTTLQLAQMV 216

  Fly   215 L--ILG---YMLTVGAKGC-----NMPKTLTFFFVGNTVIFLYLFGNFYRKTYKK 259
            :  |:|   |.:....:.|     |:......:|.     :..||.||:...|.|
 Worm   217 MGVIIGVTVYRIKSSGEYCQQTWDNLGLCFGVYFT-----YFLLFANFFYHAYVK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 63/249 (25%)
elo-3NP_001367447.1 ELO 33..270 CDD:395916 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.