DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elo-4

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_499056.1 Gene:elo-4 / 183367 WormBaseID:WBGene00001242 Length:291 Species:Caenorhabditis elegans


Alignment Length:264 Identity:73/264 - (27%)
Similarity:121/264 - (45%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WFLMSSPMPVVAVVLVYLAFVL-KIGPEYMKNRKPMDLKRIMVFYN----AFQVLYSIWMCRTSI 85
            |.::.......::.:..|.|:| |:..::|:||||..||..::.:|    ||.::.::   |.||
 Worm    44 WTILFQKYWYHSITISVLYFILIKVIQKFMENRKPFTLKYPLILWNGALAAFSIIATL---RFSI 105

  Fly    86 QESNVMASIFSKKCEINRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYH 148
               :.:.|::::..........|.|..:..|.:.|  |||::|.||.|.:|||:  .:.|||.||
 Worm   106 ---DPLRSLYAEGFYKTLCYSCNPTDVAAFWSFAFALSKIVELGDTMFIILRKR--PLIFLHYYH 165

  Fly   149 HTITVLFSWGYLKYAPGEQ---GVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQL 210
            |...::    |..::..|.   |....::|...|.:||.||.|:|||  |:...|....:|::|.
 Worm   166 HAAVLI----YTVHSGAEHTAAGRFYILMNYFAHSLMYTYYTVSAMG--YRLPKWVSMTVTTVQT 224

  Fly   211 IQFVLILG-----------YMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTY-----KK 259
            .|.:..:|           |.|.......|:......:     |.|..||..|:.|.|     ||
 Worm   225 TQMLAGVGITWMVYKVKTEYKLPCQQSVANLYLAFVIY-----VTFAILFIQFFVKAYIIKSSKK 284

  Fly   260 AKSV 263
            :|||
 Worm   285 SKSV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 69/260 (27%)
elo-4NP_499056.1 ELO 48..278 CDD:279492 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.