DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elo-1

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:241 Identity:68/241 - (28%)
Similarity:120/241 - (49%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VAVVLVYLAFVLKIGPE-YMKNRKPMDLKRIMVFYN----AFQVLYSIWMCRT---SIQESNVMA 92
            |.:....|..|:..|.: :|:||:|..|...:..:|    ||.:..::.|...   :|....::|
 Worm    46 VTIQASILYMVVVFGTKWFMRNRQPFQLTIPLNIWNFILAAFSIAGAVKMTPEFFGTIANKGIVA 110

  Fly    93 SIFSKKCEI-NRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVL 154
            |.    |:: :.|:.:|     |.|.:.|  ||:.:|:||.|.||||:  .:.|||.|||.:|::
 Worm   111 SY----CKVFDFTKGEN-----GYWVWLFMASKLFELVDTIFLVLRKR--PLMFLHWYHHILTMI 164

  Fly   155 FSWGYLKYAPG--EQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVLI- 216
            ::|......||  ..|:   .||..||..||.||.:.:|..:...::  .:.:||:|::||::. 
 Worm   165 YAWYSHPLTPGFNRYGI---YLNFVVHAFMYSYYFLRSMKIRVPGFI--AQAITSLQIVQFIISC 224

  Fly   217 -----LGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTY 257
                 |||::......|:...::....|.....:|.||.||:.::|
 Worm   225 AVLAHLGYLMHFTNANCDFEPSVFKLAVFMDTTYLALFVNFFLQSY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 68/241 (28%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.