DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl6

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:262 Identity:66/262 - (25%)
Similarity:117/262 - (44%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSW---FLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTSI 85
            ::|   ||.|:         :|.||:.. |...|..|...:|::.:|.::....::||:   .::
  Rat    28 ENWKKSFLFSA---------LYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIF---GAL 79

  Fly    86 QESNVMASIFSKKCEINRTREQNLTLYSGA----WFYFF--SKIIDLLDTTFFVLRKKDNQVSFL 144
            :....|..|...|.......:|  :.|:|.    |.|.|  ||..:|.||.|.:|||:  ::.||
  Rat    80 RTGAYMLYILMTKGLKQSVCDQ--SFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQ--KLIFL 140

  Fly   145 HVYHHTITVLFSW-GYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSI 208
            |.|||...:|:|| .|.....|  |.....:|.|||.:||.||.:.|.|.:..:.  :..::|..
  Rat   141 HWYHHITVLLYSWYSYKDMVAG--GGWFMTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLS 201

  Fly   209 QLIQFVL--ILGYMLTVGAKGCNMPKTLTFF---------FVGNTVIFLYLFGNFYRKTYKKAKS 262
            |:.|.::  ::.|::....:..| .:..:.|         ::...::|.:.|...|....|||..
  Rat   202 QITQMLMGCVINYLVFNWMQHDN-DQCYSHFQNIFWSSLMYLSYLLLFCHFFFEAYIGKVKKATK 265

  Fly   263 VD 264
            .:
  Rat   266 AE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 65/252 (26%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.