DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl5

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:250 Identity:87/250 - (34%)
Similarity:139/250 - (55%) Gaps:9/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84
            |..|..|||:.:.:|......:|| .::.:||:|||||:|...:.|:|.||....|.|::|....
  Rat    20 DTRVKGWFLLDNYIPTFVCSAIYL-LIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYEL 83

  Fly    85 IQESNVMASIFSKKCEINRTR-EQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYH 148
            :  :.|....::..|:..|:. |.::.:....|:|:|||:|:.:||.||:|||.::|::.|||||
  Rat    84 V--TGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYH 146

  Fly   149 HTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQF 213
            |...:...|..:.:.|.........|||.:|::||.||.:::: |..:.|||||||:|..||:||
  Rat   147 HATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQF 210

  Fly   214 VLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSR 268
            ||.:..........|:.|....:|.:|..:..:.||.|||.:||.|    .|.||
  Rat   211 VLTIIQTSCGVIWPCSFPLGWLYFQIGYMISLIALFTNFYIQTYNK----KGASR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 81/235 (34%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.