DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and Elovl3

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_031729.1 Gene:Elovl3 / 12686 MGIID:1195976 Length:271 Species:Mus musculus


Alignment Length:246 Identity:70/246 - (28%)
Similarity:120/246 - (48%) Gaps:45/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI------WMCRTSIQ-----ESNVM 91
            :|:|||..:: :|..||:.||...|:|.::.::.|..::||      |....::.     :..|.
Mouse    41 IVVVYLLLIV-VGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVC 104

  Fly    92 ASIFSKKCEINRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVL 154
            .:|::....:.            .|.:.|  ||:::|.||.|.:|||:  .:.|:|.|||:..:|
Mouse   105 FAIYTDDAVVR------------FWSFLFLLSKVVELGDTAFIILRKR--PLIFVHWYHHSTVLL 155

  Fly   155 F-SWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVL--- 215
            | |:||....|  .|.....:|.|||.:||.||.:.|...::...|  ...:||:|::|.||   
Mouse   156 FTSFGYKNKVP--SGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLL--PMVITSLQILQMVLGTI 216

  Fly   216 --ILGYMLTVGAKGCNMPKTLTFFFVGNTVI---FLYLFGNFYRKTYKKAK 261
              ||.|:.. ..|||:   |.|..|..:.::   :..||.:|:.:.|.:.|
Mouse   217 FGILNYIWR-QEKGCH---TTTEHFFWSFMLYGTYFILFAHFFHRAYLRPK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 70/246 (28%)
Elovl3NP_031729.1 ELO 52..267 CDD:366492 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.