DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bond and elovl4

DIOPT Version :9

Sequence 1:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002936253.1 Gene:elovl4 / 100496222 XenbaseID:XB-GENE-953769 Length:328 Species:Xenopus tropicalis


Alignment Length:299 Identity:103/299 - (34%)
Similarity:164/299 - (54%) Gaps:12/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTS 84
            |:.|:.|.||.||:|.:|:...|| .|:.:||::||||:|..|:.:::.||...|:.:.::.:..
 Frog    24 DKRVEKWPLMQSPLPTLAISTAYL-LVVWLGPKFMKNREPFQLRYLLIAYNFGMVILNFFIFKEL 87

  Fly    85 IQESNVMASIFSKKCE-INRTREQN-LTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVY 147
            .  ....|:.:|..|: ::.:.::| :.:.|..|:|:.||.::..||.||:||||.||:||||||
 Frog    88 F--LGAKAAGYSYICQPVDYSDDENEVRVASALWWYYVSKGVEYFDTVFFILRKKFNQISFLHVY 150

  Fly   148 HHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQ 212
            ||.......|..:|:..|.|......:|:.:|::||.||.:||.||..|||||||:|:|.:||:|
 Frog   151 HHCTMFTLWWIGIKWVAGGQSFFGAHMNALIHVVMYLYYGLAACGPHLQKYLWWKRYLTILQLVQ 215

  Fly   213 FVLILGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQS 277
            |.:.:|:........|..||.:.:..:...:.|:.||.|||.:||...|:    ...:|.||...
 Frog   216 FHVTIGHTALSLYIDCPFPKWMHWALIVYAITFIILFVNFYYRTYNAPKA----PAKSGKSLING 276

  Fly   278 ALRAAGGMGCMPQTMNAGKHLLQNGQVGKAYIDLNNNSV 316
            .....|......:....||  |.||.|..| :...:|.|
 Frog   277 KTSVNGKSSVNGKCQINGK--LMNGAVNGA-VSKQDNKV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bondNP_651062.3 ELO 27..262 CDD:279492 86/236 (36%)
elovl4XP_002936253.1 ELO 31..268 CDD:366492 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.