DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and IZH4

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_014540.1 Gene:IZH4 / 854052 SGDID:S000005461 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:58/249 - (23%)
Similarity:104/249 - (41%) Gaps:22/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 HLLG-----CIAFIGVALYFISR-PSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMG 268
            :|||     |:.......|.|.. |:....| :.|||..:.:...|.....|.:|.:...|::..
Yeast    70 YLLGSMLSFCLLIFFTDFYLIPLFPTTTTMT-DYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQH 133

  Fly   269 -RLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRP 332
             ..:.|..|.....|::.|.:..|||.||.:.....|:..:::.:|:::....|.||... :.|.
Yeast   134 LEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLIS-SKRF 197

  Fly   333 LRAGVFMSF-----GLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERW 392
            .:...|:|.     .|..:...|.:..:|....::...::.|.:   :..:..:::|..|.||..
Yeast   198 NKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWEL---VALVAASIIYVTRFPESL 259

  Fly   393 F--PGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSECTVPIEPITF 444
            |  ..|.:.|..|..:||:|:...||  ||....:..|.:|:|....| |.|.|
Yeast   260 FRRNKKEEGWNHSEYLFHLLISGTAF--YHFFILIQSYILMHSSLNQP-ELINF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 49/222 (22%)
IZH4NP_014540.1 HlyIII 27..298 CDD:413828 52/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001022
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.