DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and AT4G38290

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_195542.1 Gene:AT4G38290 / 829986 AraportID:AT4G38290 Length:108 Species:Arabidopsis thaliana


Alignment Length:52 Identity:38/52 - (73%)
Similarity:44/52 - (84%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 GWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHY 419
            |:.|||||||.||||:||.|:||||.||||||.|.|||:||:||:|.||.||
plant    42 GYEILMGLLYGLGALVYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAFTHY 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 36/50 (72%)
AT4G38290NP_195542.1 HlyIII <42..93 CDD:383485 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.