DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and AT2G40710

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_181603.1 Gene:AT2G40710 / 818666 AraportID:AT2G40710 Length:93 Species:Arabidopsis thaliana


Alignment Length:78 Identity:44/78 - (56%)
Similarity:55/78 - (70%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQI 406
            |.||:.|.:|..|: .|....:..:..:.|||||||.||||:||.|:||||.||||||.|.|||:
plant     2 GFSGLAPILHKLII-FWDQPEALHTTCYEILMGLLYGLGALVYATRIPERWMPGKFDIAGHSHQL 65

  Fly   407 FHILVIAAAFVHY 419
            ||:||:|.||.||
plant    66 FHVLVVAGAFTHY 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 42/76 (55%)
AT2G40710NP_181603.1 HlyIII <1..78 CDD:296067 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.