DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and PAQR6

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_024305646.1 Gene:PAQR6 / 79957 HGNCID:30132 Length:551 Species:Homo sapiens


Alignment Length:100 Identity:29/100 - (28%)
Similarity:41/100 - (41%) Gaps:29/100 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PALR---PLRAGVFM---SFGLSGVI--PAIHYSIM-----------------EGWFSQMSRASL 367
            |.||   ||::| |:   |.|||.|:  .|..|..:                 .|...:....|.
Human   254 PRLRRAQPLQSG-FLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSH 317

  Fly   368 GWLILMGLLYILGALLYALRVPERWFPGKFDIWGQ 402
            |:.:...|   |...|:|..:|||..||:||..|:
Human   318 GYHLFCAL---LTGFLFASHLPERLAPGRFDYIGE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 29/99 (29%)
PAQR6XP_024305646.1 HlyIII <276..350 CDD:322438 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.