DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr4

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_076313.1 Gene:Paqr4 / 76498 MGIID:1923748 Length:273 Species:Mus musculus


Alignment Length:272 Identity:79/272 - (29%)
Similarity:131/272 - (48%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFIS 226
            ::..:.:.|..||.|.|:..|:| |..|...|.:|:|.:|.|.|||:||.|..:.|:  .|..::
Mouse     8 RLLDWASSPPHLQFNKFVLTGYR-PASSGSGCLRSLFYLHNELGNIYTHGLALLGFL--VLVPMT 69

  Fly   227 RPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCH---SVEMGRLFSKLDYCGIALLIMGSFV 288
            .|..:: .::..:.|...:..:|....|..:|...||   |....||.: ||.||:.|:.....:
Mouse    70 MPWSQL-GKDGWLGGTHCVACLVPPAASVLYHLFMCHQGGSPVYTRLLA-LDMCGVCLVNTLGAL 132

  Fly   289 PWLYYGFYCHYQPKVIYLSVVSILGILSIV-VSLWDKFSEPA----LRPL--RAGV-FMSFGLSG 345
            |.::....|  :|   :|...:::|..::. |:.|...:.|:    ||..  :||. .:.||..|
Mouse   133 PIIHCTLAC--RP---WLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQAGARLLVFGARG 192

  Fly   346 VIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHIL 410
            |      .:..|     :..||...:.|..|.:||.|:...|:||||.||:||.||.||||.|:|
Mouse   193 V------GLGSG-----APGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLL 246

  Fly   411 VIAAAFVHYHGI 422
            .:.:....:.|:
Mouse   247 SVGSILQLHAGV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 67/231 (29%)
Paqr4NP_076313.1 HlyIII 43..254 CDD:383485 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.