DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr9

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_940806.2 Gene:Paqr9 / 75552 MGIID:1922802 Length:375 Species:Mus musculus


Alignment Length:348 Identity:80/348 - (22%)
Similarity:121/348 - (34%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AGVLSDEIDLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDND-----FLHRGHRPPLP 188
            |||..........:|.|:..|..        |......|.|.:|.:..|     |:..|:|....
Mouse    10 AGVKGPPASTSRRSHPASASAPR--------SPPAATTKPLLRWDEVPDDFVECFILSGYRRLPC 66

  Fly   189 SFRACFKSIFRVHTETGNIWTHLLGCIAFIG--VALYFISRPSVEIQTQEKIVFGAFFIGAIVCL 251
            :.:.|..|:.:...||.|.|||.:..:.|:.  ..|:|:....|.......:....:..|.::..
Mouse    67 TAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLGGSDVPFHHPWLLPLWCYASGVLLTF 131

  Fly   252 GFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYY---------------------GF 295
            ..|...|..||.|:.:...|..|||..|:....||.|.:.||                     |:
Mouse   132 AMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPSLSLLDARVMTPYVQQRLGW 196

  Fly   296 YCH-------YQPKVIYLSVVSILGILSIVV---SLWDKFSEPALRPLRAGVFMS---------- 340
            :..       |  :.:.|.|..:|.:...|.   |..|..|.|.  .||..||:.          
Mouse   197 HVDCTRLIAVY--RALVLPVAFVLAVACTVACCKSRTDWCSYPF--ALRTFVFVMPLSMACPIML 257

  Fly   341 ----FGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWG 401
                |.|.|..|.:.......:|         ||       ::.|.....::|||..||.|||.|
Mouse   258 ESWLFDLRGENPTLFVHFYRRYF---------WL-------VVAAFFNVSKIPERIQPGLFDIIG 306

  Fly   402 QSHQIFHILVIAAAFVHYHGISE 424
            .|||:|||....:.:...:.:.|
Mouse   307 HSHQLFHIFTFLSIYDQVYYVEE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 63/267 (24%)
Paqr9NP_940806.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 7/36 (19%)
HlyIII 79..318 CDD:296067 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.