DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr5

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_083024.1 Gene:Paqr5 / 74090 MGIID:1921340 Length:330 Species:Mus musculus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:113/260 - (43%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIG---VALYFISRPSVEIQTQE----KIV 239
            |:|.|..|..||..|:|::..||.|||||||....|:.   .|||.     .:||...    .:|
Mouse    27 GYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYV-----TDIQNDSYSWPMLV 86

  Fly   240 FGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVI 304
            :  .....:..|..|.| ||.|..|.....:...|||..:.|..:||.:.:..|.|     |..:
Mouse    87 Y--MCTSCVYPLASSCA-HTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTF-----PDAL 143

  Fly   305 --------YLSVVSILGILSIVVSLWDKFSE---PAL-RPLRAGVFMSFGLSGVIPAIHYSIMEG 357
                    |:::..:..|||..:|.:.:|.|   |.| :.||...|........:|..:...:..
Mouse   144 VCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRLFLFP 208

  Fly   358 WFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGI 422
            ..|..:.|.|.....||:. :|.:..|:..:|||..||:||..|.|||:||:.||.|..:....|
Mouse   209 GESSRNEAMLYHQKHMGMT-LLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAI 272

  Fly   423  422
            Mouse   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 69/239 (29%)
Paqr5NP_083024.1 HlyIII 43..269 CDD:281059 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.