DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr6

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_006502070.3 Gene:Paqr6 / 68957 MGIID:1916207 Length:426 Species:Mus musculus


Alignment Length:272 Identity:73/272 - (26%)
Similarity:107/272 - (39%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIG 246
            |:|.|..|...|..|.|::..||.|||||.|....|:. .|..:..|........ :....|.:.
Mouse    85 GYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLW-RLLALGSPGFRADPYH-LPLLVFLLP 147

  Fly   247 AIVCLGFSFA---FHTLSCHSVEMGRLFSKLDYCGIAL-------------------------LI 283
            |  || :.||   .||.|..|.....:...|||..::|                         |.
Mouse   148 A--CL-YPFASCCAHTFSSMSPRARHICYFLDYGALSLYSLGELRAVGLDGGAEGEPSSLSSHLA 209

  Fly   284 MGSFVPWLYYGF---YCHYQPKVIYLSVVSILGILSIVVSLWDKFSE---PAL-RPLRAGVFMSF 341
            .|...|:..|..   :.|.:...:::...::...|...:|.:.:|.|   |.. :.||...|...
Mouse   210 TGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPELEYPGFSKALRTAAFAYP 274

  Fly   342 GLSGVIPAIHYSIMEGWFSQMS--RASL----GWLILMGLLYILGALLYALRVPERWFPGKFDIW 400
            .|...:| :.|.:...|....|  |.:|    |:.:|..|   |...|:|.|:|||..||:||..
Mouse   275 FLFDNLP-LFYRLRLCWGGAHSCGRDALSSNHGYHLLCAL---LSGFLFAARLPERLAPGRFDYI 335

  Fly   401 GQSHQIFHILVI 412
            |.|||:|||..:
Mouse   336 GHSHQLFHICAV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 67/256 (26%)
Paqr6XP_006502070.3 HlyIII 101..354 CDD:367292 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.