DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr6

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_017446590.2 Gene:Paqr6 / 681021 RGDID:1584722 Length:358 Species:Rattus norvegicus


Alignment Length:252 Identity:71/252 - (28%)
Similarity:107/252 - (42%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIG 246
            |:|.|..|...|..|.|::..||.|||||.|....|:. .|..:..|....:        .:.:.
  Rat    42 GYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLW-RLLALGSPGFHAE--------PYHLP 97

  Fly   247 AIV-----CLGFSFA---FHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGF---YCHYQ 300
            .:|     || :.||   .||.|..|.....:...|||..::|..:|...|:..|..   :.|.:
  Rat    98 LLVFLLPTCL-YPFASCCAHTFSSMSPRARHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHSR 161

  Fly   301 PKVIYLSVVSILGILSIVVSLWDKFSE---PAL-RPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQ 361
            ...:::...::...|...:|.:.:|.|   |.| :.||...|....|...:| :.|.:...|...
  Rat   162 LHQLFVPAAALNSFLCTGLSCYSRFPELENPGLSKVLRTAAFAYPFLFDNLP-LFYRLRLCWGRA 225

  Fly   362 MS------RASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVI 412
            .|      ..|.|:.:|..|   |...|:|.|:|||..||:||..|.|||:|||..:
  Rat   226 HSCGRDALSCSHGYHLLCAL---LTGFLFAARLPERLAPGRFDYIGHSHQLFHICAV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 65/236 (28%)
Paqr6XP_017446590.2 HlyIII 58..286 CDD:397239 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.