DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and PAQR5

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001098024.1 Gene:PAQR5 / 54852 HGNCID:29645 Length:330 Species:Homo sapiens


Alignment Length:280 Identity:77/280 - (27%)
Similarity:118/280 - (42%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAF---IGVALYFISRPSV 230
            :|:...:...|. |:|.|..|..||..|:|::..||.|||||||....|   ...|||.     .
Human    15 IPQVFHEQGILF-GYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYM-----T 73

  Fly   231 EIQTQE----KIVFGAFFIGAIVCLG-----FSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGS 286
            :|:...    .:|:        :|..     .|...||.|..|.....:...|||..:.|..:||
Human    74 DIKNDSYSWPMLVY--------MCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGS 130

  Fly   287 FVPWLYYGFYCHYQPKVI--------YLSVVSILGILSIVVSLWDKFSE---PAL-RPLRAGVFM 339
            .:.:..|.|     |..:        |:::..:..|||..:|.:.:|.|   |.| :.:|...|.
Human   131 AIAYSAYTF-----PDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFA 190

  Fly   340 SFGLSGVIPAIHYS--IMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQ 402
            .......:| |.|.  :..|..:|....|.....:  ::.:|.:.||:..:|||..||:||..|.
Human   191 YPYTWDSLP-IFYRLFLFPGESAQNEATSYHQKHM--IMTLLASFLYSAHLPERLAPGRFDYIGH 252

  Fly   403 SHQIFHILVIAAAFVHYHGI 422
            |||:||:.||.|..:....|
Human   253 SHQLFHVCVILATHMQMEAI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 67/246 (27%)
PAQR5NP_001098024.1 HlyIII 43..269 CDD:308575 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.