DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and paqr5a

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_956481.1 Gene:paqr5a / 393156 ZFINID:ZDB-GENE-040426-867 Length:345 Species:Danio rerio


Alignment Length:305 Identity:78/305 - (25%)
Similarity:122/305 - (40%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQ 233
            :||...: |.:..|:|.|..|.:.|..|:|::..||.|||||.|....|:...|..:    :.::
Zfish    16 VPKVFHE-DGIISGYRHPCSSAKDCVLSLFQLTNETLNIWTHFLPTWFFLWKLLTVV----LVLE 75

  Fly   234 TQEKIVFGAFFIGAIVCLGFSFA---FHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGF 295
            .........|.:..:.|..:..|   .||.|..|.....:....||..::...:||.:.:..|.|
Zfish    76 DWRDPFIWPFLVFLLSCCVYPLASSCAHTFSTMSERARHICFFFDYGALSFYSLGSAIIYSSYSF 140

  Fly   296 YCHYQPKVIYLSVVSIL---GILSIVVSLWDKFSEPAL--------RP-----------LRAGVF 338
            ...:.....:|:.|||.   .|:|..::.:.:...|.|        ||           ||...|
Zfish   141 PDKWVNGTFHLNYVSIAVVNSIISTALACYSRLGLPFLEYNCHSIKRPSGKLDQKLCKCLRIIAF 205

  Fly   339 MSFGLSGVIPAIHYSIM----EGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDI 399
            :...|...|| :.|.|.    ||  ..::.|:........|.:..| .|:|..:|||..||.||.
Zfish   206 VYPYLFDNIP-LFYRIFVCAGEG--CTVNEANTVHYQHTSLAFFTG-FLFATHLPERLAPGSFDY 266

  Fly   400 WGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSECTVPIEPITF 444
            .|.|||:||:..|...:.....|......|..:....:|  |:||
Zfish   267 IGHSHQLFHVFAIIGTYFQMTAIELDMAARKQWLHAHLP--PVTF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 63/249 (25%)
paqr5aNP_956481.1 HlyIII 44..286 CDD:281059 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.