DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and CG4615

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster


Alignment Length:308 Identity:60/308 - (19%)
Similarity:111/308 - (36%) Gaps:67/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LAHNAAEQAEEFVRKVWEASWK--VCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTE 203
            |.|..|     |:..::...||  :....||...|::..:.:...:|      .|......:. :
  Fly    34 LQHKYA-----FLENLFSKFWKSIIKSNSNLKLQLRNVKWKNAKAKP------GCAYQPTEIE-Q 86

  Fly   204 TGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFA--FHTLSCHSVE 266
            ..|:.||.:..:..:..|:....|.|   ...:.:|  |:..|..:|:.|:.:  || .||:..|
  Fly    87 VANVITHGIWILPAVFAAIKLFERSS---SASQYLV--AWVYGGALCMLFTVSTFFH-CSCYCAE 145

  Fly   267 --------------------MGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSI 311
                                :..:..:.|...|.:.|.||:.|||......|   ..|...:..:
  Fly   146 HKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLENTDH---SAILFCMEWV 207

  Fly   312 LGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLL 376
            :.:::.:...:.:......:.|....::..||.   ||:........|..|.:...|     |..
  Fly   208 IWLMAGIGIAYQQVFHERYKCLETFFYLVMGLG---PALVVVFTGHHFHGMMQLKFG-----GGF 264

  Fly   377 YILGALLYAL--RVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGI 422
            ||||.:.:..  .:|            .:|.|:|:.|:.||..||:.|
  Fly   265 YILGIVFFKADGTIP------------MAHAIWHLFVVLAAGCHYYAI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 46/244 (19%)
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.