DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr9

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001258081.2 Gene:Paqr9 / 315904 RGDID:1311515 Length:373 Species:Rattus norvegicus


Alignment Length:310 Identity:73/310 - (23%)
Similarity:112/310 - (36%) Gaps:72/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KNLPKWLQDND-----FLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIG--VALYF 224
            |.|.:|.:..|     |:..|:|....:.:.|..|:.:...||.|.|||.:..:.|:.  ..|:|
  Rat    38 KPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFF 102

  Fly   225 ISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVP 289
            :....|.......:....:..|.::....|...|..||.|:.:...|..|||..|:....||.|.
  Rat   103 LGGSDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVA 167

  Fly   290 WLYY---------------------GFYCH-------YQPKVIYLSVVSILGILSIVV---SLWD 323
            :.||                     |::..       |  :.:.|.|..:|.:...|.   |..|
  Rat   168 YYYYLLPSLSLLDARVMTPYVQQRLGWHVDCTRLIAVY--RALVLPVAFVLAVACTVACCKSRTD 230

  Fly   324 KFSEPALRPLRAGVFMS--------------FGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMG 374
            ..|.|.  .||..||:.              |.|.|..|.:.......:|         ||    
  Rat   231 WCSYPF--ALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYF---------WL---- 280

  Fly   375 LLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISE 424
               ::.|.....::|||..||.|||.|.|||:|||....:.:...:.:.|
  Rat   281 ---VVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 63/267 (24%)
Paqr9NP_001258081.2 HlyIII 77..316 CDD:413828 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.