DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr5

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001014114.1 Gene:Paqr5 / 315741 RGDID:1311259 Length:330 Species:Rattus norvegicus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:114/260 - (43%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIG---VALYFISRPSVEIQTQE----KIV 239
            |:|.|..|..||..|:|::..||.|||||||....|:.   .|||.     .:||...    .:|
  Rat    27 GYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFMWRFMTALYM-----TDIQNDSYSWPLLV 86

  Fly   240 FGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVI 304
            :  .....:..|..|.| ||.|..|.....:...|||..:.|..:||.:.:..|.|     |..:
  Rat    87 Y--MCTSCVYPLASSCA-HTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTF-----PDAL 143

  Fly   305 --------YLSVVSILGILSIVVSLWDKFSE---PAL-RPLRAGVFMSFGLSGVIPAIHYSIMEG 357
                    |:::..:..|||..:|.:.:|.|   |.| :.||...|........:|..:...:..
  Rat   144 VCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYAWDSLPIFYRLFLFP 208

  Fly   358 WFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGI 422
            ..|..:.|.|.....| ::.:|.:.||:..:|||..||:||..|.|||:||:.||.|..:....|
  Rat   209 GESSRNEAMLYHQKHM-VMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAI 272

  Fly   423  422
              Rat   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 69/239 (29%)
Paqr5NP_001014114.1 HlyIII 43..269 CDD:281059 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.