DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Mmd

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001007674.1 Gene:Mmd / 303439 RGDID:1592079 Length:238 Species:Rattus norvegicus


Alignment Length:290 Identity:67/290 - (23%)
Similarity:99/290 - (34%) Gaps:106/290 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 HRPPL-----PSFRACFKSIFRVHTETGNIWTHLLGCI-AFIGVALYFISRPSVEIQTQEKIVFG 241
            ||.|.     |:   |::       ...|.:||....: |.:|.||  :.|.|.:  ..|||.  
  Rat    13 HRAPANGRYKPT---CYE-------HAANCYTHAFLIVPAIVGSAL--LHRLSDD--CWEKIT-- 61

  Fly   242 AFFIGAIVCLGF--SFAFHTLS---CHSVEMGRLFSKLDYCGIALLIMGSFVPWL---------- 291
            |:..|..:|..|  |..||.:|   .|...:...|...|...|...|..|:.|||          
  Rat    62 AWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLAS 126

  Fly   292 --------------YYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFG 342
                          .|.|..|.:.||:.|.                             .:::.|
  Rat   127 HMRWFIWLMAAGGTIYVFLYHEKYKVVELF-----------------------------FYLTMG 162

  Fly   343 LSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFD-IWGQSHQI 406
            .|   ||:..:.|.      :...|..|...||:|.||.:.:           |.| |...:|.|
  Rat   163 FS---PALVVTSMN------NTDGLQELACGGLIYCLGVVFF-----------KSDGIIPFAHAI 207

  Fly   407 FHILVIAAAFVHYHGISEMAMYRVMYSECT 436
            :|:.|..||.|||:     |:::.:|...|
  Rat   208 WHLFVATAAAVHYY-----AIWKYLYRSPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 57/251 (23%)
MmdNP_001007674.1 hlyIII 27..227 CDD:273425 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.