DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Paqr4

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001017377.1 Gene:Paqr4 / 302967 RGDID:1309533 Length:273 Species:Rattus norvegicus


Alignment Length:272 Identity:78/272 - (28%)
Similarity:130/272 - (47%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFIS 226
            ::..:.:.|..||.|.|:..|:| |..|...|.:|:|.:|.|.|||:||.|..:.|:  .|..::
  Rat     8 RLLDWASSPPHLQFNKFVLTGYR-PASSGSGCLRSLFYLHNELGNIYTHGLALLGFL--VLVPMT 69

  Fly   227 RPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCH---SVEMGRLFSKLDYCGIALLIMGSFV 288
            .|..:: .::..:.|...:..:.....|..:|...||   |....||.: ||.||:.|:.....:
  Rat    70 MPWSQL-GKDGWLGGTHCVACLAPPAASVLYHLFMCHQGGSPVYTRLLA-LDMCGVCLVNTLGAL 132

  Fly   289 PWLYYGFYCHYQPKVIYLSVVSILGILSIV-VSLWDKFSEPA----LRPL--RAGV-FMSFGLSG 345
            |.::....|  :|   :|...:::|..::. |:.|...:.|:    ||..  :||. .:.||..|
  Rat   133 PIIHCTLAC--RP---WLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQAGARLLVFGARG 192

  Fly   346 VIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHIL 410
            |      .:..|     :..||...:.|..|.:||.|:...|:||||.||:||.||.||||.|:|
  Rat   193 V------GLGSG-----APGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLL 246

  Fly   411 VIAAAFVHYHGI 422
            .:.:....:.|:
  Rat   247 SVGSILQLHAGV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 66/231 (29%)
Paqr4NP_001017377.1 HlyIII 43..254 CDD:413828 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.